Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q77DJ6
Gene Names: VP40
Organism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
AA Sequence: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK
Expression Region: 1-326AA
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 51.2 kDa
Alternative Name(s): Membrane-associated protein VP40
Relevance: Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. The hexamer form ses to be involved in budding. The octamer form binds RNA, and may play a role in genome replication .
Reference: Chain P.S.G., Ichou M.A., Malfatti S.A., Hajjaj A., Vergez L.M., Paragas J., Do L.H., Jahrling P.B., Smith K.L., McCready P.M., Ibrahim M.S.Crystal structure of the matrix protein VP40 from Ebola virus.Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W.EMBO J. 19:4228-4236(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.