Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)

CSB-MP813457VFI
Regular price
$509.00 USD
Sale price
$509.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-25 working days

Research Topic: Microbiology

Uniprot ID: Q8DDU2

Gene Names: nfuA

Organism: Vibrio vulnificus (strain CMCP6)

AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Expression Region: 1-194aa

Sequence Info: Full Length

Source: Mammalian cell

Tag Info: C-terminal FC-tagged

MW: 47 kDa

Alternative Name(s):

Relevance: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Reference: "Complete genome sequence of Vibrio vulnificus CMCP6."Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
    Regular price
    $952.00 USD
    Sale price
    $952.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
    Regular price
    $509.00 USD
    Sale price
    $509.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
    Regular price
    $743.00 USD
    Sale price
    $743.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Fe-S biogenesis protein NfuA(nfuA)
    Regular price
    $867.00 USD
    Sale price
    $867.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share