
Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-25 working days
Research Topic: Microbiology
Uniprot ID: Q8DDU2
Gene Names: nfuA
Organism: Vibrio vulnificus (strain CMCP6)
AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
Expression Region: 1-194aa
Sequence Info: Full Length
Source: Mammalian cell
Tag Info: C-terminal FC-tagged
MW: 47 kDa
Alternative Name(s):
Relevance: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.
Reference: "Complete genome sequence of Vibrio vulnificus CMCP6."Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
- Regular price
- $952.00 USD
- Sale price
- $952.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
- Regular price
- $509.00 USD
- Sale price
- $509.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vibrio vulnificus Fe-S biogenesis protein NfuA(nfuA)
- Regular price
- $743.00 USD
- Sale price
- $743.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Fe-S biogenesis protein NfuA(nfuA)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out