Recombinant Vaccinia virus Protein I5(VACWR074)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Vaccinia virus Protein I5(VACWR074)

CSB-CF318298VAI
Regular price
$761.00 USD
Sale price
$761.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: P12924

Gene Names: VACWR074

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS

Expression Region: 2-79aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.6 kDa

Alternative Name(s): Protein VP13K

Relevance: Envelope protein

Reference: "Sequence and transcriptional analysis of the vaccinia virus HindIII I fragment."Schmitt J.F.C., Stunnenberg H.G.J. Virol. 62:1889-1897(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share