Recombinant Vaccinia virus Protein I2 (VACWR071)

CSB-CF304731VAI

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:P68606

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKLYAAIFGVFMGSPEDDLTDFIEIVKSVLSDEKTVTSTNNTGCWGWYWLIIIFFIVLI LLLLIYLYLKVVW

Protein Names:Recommended name: Protein I2

Gene Names:Ordered Locus Names:VACWR071 ORF Names:I2L

Expression Region:1-73

Sequence Info:full length protein