
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q402I5
Gene Names: N/A
Organism: Triticum aestivum (Wheat)
AA Sequence: QQQFPQQQSPQQQQFPQQQFPQQQQLPQKQFPQPQQIPQQQQIPQQPQQFPQQQFPQQQQFPQQQEFPQQQFPQQQFHQQQLPQQQFPQQQFPQQQFPQQQQFPQQQQLTQQQFPRPQQSPEQQQFPQQQFPQQPPQQFPQQQFPIPYPPQQSEEPSPYQQYPQQQPSGSDVISISGL
Expression Region: 262-439aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 37.5 kDa
Alternative Name(s):
Relevance:
Reference: "Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis."Matsuo H., Kohno K., Morita E.FEBS J. 272:4431-4438(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Triticum aestivum Gamma-gliadin(gliadin),partial
- Regular price
- $871.00 USD
- Sale price
- $871.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Triticum aestivum Alpha-beta-gliadin A-II
- Regular price
- $741.00 USD
- Sale price
- $741.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Triticum monococcum Omega-gliadin
- Regular price
- $955.00 USD
- Sale price
- $955.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Triticum aestivum Alpha-beta-gliadin MM1
- Regular price
- $871.00 USD
- Sale price
- $871.00 USD
- Regular price
-
- Unit price
- per
Sold out