Recombinant Synsepalum dulcificum Miraculin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Synsepalum dulcificum Miraculin

CSB-EP320179RES
Regular price
$738.00 USD
Sale price
$738.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

Delivery time: 3-7 business days

Uniprot ID: P13087

AA Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Tag info: N-terminal 10xHis-tagged

Expression Region: 30-220aa

Protein length: Full Length of Mature Protein

MW: 24.9 kDa

Alternative Name(s):

Relevance: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Reference: "Complete amino acid sequence and structure characterization of the taste-modifying protein, miraculin." Theerasilp S., Hitotsuya H., Nakajo S., Nakaja K., Nakamura Y., Kurihara Y. J. Biol. Chem. 264:6655-6659(1989)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share