Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Suid herpesvirus 1 (strain Kaplan) (SuHV-1) (Pseudorabies virus (strain Kaplan))
Uniprot NO.:Q87088
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SIVSTEGPLPLLREESRINFWNAACAARGVPVDQPTAAAVTFYICLLAVLVVALGYATRT CTRMLHASPAGRRV
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:GN ORF Names:UL49.5
Expression Region:25-98
Sequence Info:full length protein
You may also like
-
Recombinant Suid herpesvirus 1 Glycoprotein K(gK)
- Regular price
- $1,340.00 USD
- Sale price
- $1,340.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human herpesvirus 1 Glycoprotein N(gN)
- Regular price
- $1,147.00 USD
- Sale price
- $1,147.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Suid herpesvirus 1 Envelope glycoprotein I
- Regular price
- $1,363.00 USD
- Sale price
- $1,363.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Epstein-Barr virus Glycoprotein N(GN)
- Regular price
- $1,149.00 USD
- Sale price
- $1,149.00 USD
- Regular price
-
- Unit price
- per
Sold out