Recombinant Shigella flexneri Adenylate kinase(adk)

Recombinant Shigella flexneri Adenylate kinase(adk)

CSB-EP769467SZB
Regular price
$867.00 USD
Sale price
$867.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Signal Transduction

Target / Protein: adk

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Shigella flexneri

Delivery time: 3-7 business days

Uniprot ID: Q83M40

AA Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-214aa

Protein length: Full Length

MW: 43.6 kDa

Alternative Name(s): ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinase

Relevance: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Reference: "Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157." Jin Q., Yuan Z., Xu J., Wang Y., Shen Y., Lu W., Wang J., Liu H., Yang J., Yang F., Zhang X., Zhang J., Yang G., Wu H., Qu D., Dong J., Sun L., Xue Y. Yu J. Nucleic Acids Res. 30:4432-4441(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Shigella flexneri Adenylate kinase(adk)
    Regular price
    $867.00 USD
    Sale price
    $867.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Shigella flexneri Invasin (IpaD)
    Regular price
    $867.00 USD
    Sale price
    $867.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Adenylate kinase 2, mitochondrial(AK2)
    Regular price
    $577.00 USD
    Sale price
    $577.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Escherichia coli Adenylate kinase(adk)
    Regular price
    $867.00 USD
    Sale price
    $867.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share