Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cardiovascular
Uniprot ID:P05942
Gene Names:S100a4
Organism:Rattus norvegicus (Rat)
AA Sequence:ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Expression Region:2-101aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:18.6 kDa
Alternative Name(s):Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4)
Relevance:
Reference:"Nerve growth factor induces the genes for two proteins related to a family of calcium-binding proteins in PC12 cells." Masiakowski P., Shooter E.M. Proc. Natl. Acad. Sci. U.S.A. 85:1277-1281(1988)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:S-100 family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=504
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:24615
STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000015958
OMIM Database Link:
Lead Time Guidance:3-7 business days