
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Cancer
Uniprot ID: Q863Z5
Gene Names: IL4R
Organism: Sus scrofa (Pig)
AA Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Expression Region: 33-240aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 28.2 kDa
Alternative Name(s): CD_antigen: CD124
Relevance: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2
Reference: "Molecular cloning of the swine IL-4 receptor alpha and IL-13 receptor alpha 1 chains: effects of experimental Toxoplasma gondii and Ascaris suum infections on tissue mRNA levels." Zarlenga D.S. Jr., Dawson H., Solano-Aguilar G., Urban J.F. Jr. Submitted (MAR-2003)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Pig Interleukin-4 receptor subunit alpha(IL4R),partial
- Regular price
- $837.00 USD
- Sale price
- $837.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pig Interleukin-4 receptor subunit alpha(IL4R),partial
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interleukin-4(IL4)
- Regular price
- $576.00 USD
- Sale price
- $576.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep Interleukin-4(IL4)
- Regular price
- $866.00 USD
- Sale price
- $866.00 USD
- Regular price
-
- Unit price
- per
Sold out