Recombinant Pig Erythropoietin(EPO)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Pig Erythropoietin(EPO)

CSB-EP007743PI
Regular price
$868.00 USD
Sale price
$868.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Cardiovascular

Target / Protein: EPO

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: P49157

AA Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR

Tag info: N-terminal 6xHis-B2M-tagged

Expression Region: 27-194aa

Protein length: Full Length

MW: 32.6 kDa

Alternative Name(s):

Relevance: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.

Reference: "The porcine erythropoietin gene: cDNA sequence, genomic sequence and expression analyses in piglets." David R.B., Blom A.K., Sjaastad O.V., Harbitz I. Domest. Anim. Endocrinol. 20:137-147(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share