
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P26493
Gene Names: pal
Organism: Legionella pneumophila
AA Sequence: CSKTPGSADGGAAVGDGDATAQGLGQMTHFAGQEPGESYTTQAPHNQLYLFAYDDSTLASKYLPSVNAQAEYLKTHPGARVMIAGHTDERGSREYNVALGERRADTVAEILRMAGVSRQQIRVVSYGKERPANYGHDEASHAQNRRVEFIYEATR
Expression Region: 22-176aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 20.8 kDa
Alternative Name(s): 19KDA surface antigen PPL
Relevance: Very strongly associated with the peptidoglycan.
Reference: "Cloning, genetic analysis, and nucleotide sequence of a determinant coding for a 19-kilodalton peptidoglycan-associated protein (Ppl) of Legionella pneumophila."Ludwig B., Schmid A., Marre R., Hacker J.Infect. Immun. 59:2515-2521(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Peptidoglycan-associated lipoprotein(pal)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human T-cell surface glycoprotein CD1c(CD1C),partial
- Regular price
- $837.00 USD
- Sale price
- $837.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Perilipin-4(PLIN4),partial
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out