Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q7S6U4
Gene Names: NCU05495
Organism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF
Expression Region: 1-111aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.9 kDa
Alternative Name(s):
Relevance: Mannose-binding lectin.
Reference: "A designed chimeric cyanovirin-N homolog lectin: structure and molecular basis of sucrose binding." Koharudin L.M., Furey W., Gronenborn A.M. Proteins 77:904-915(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.