Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P9WIN8
Gene Names: mpt64
Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Expression Region: 24-228aa
Sequence Info: Full Length of Mature Protein
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged
MW: 24.5 kDa
Alternative Name(s): Antigen MPT64
Relevance:
Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains." Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M. J. Bacteriol. 184:5479-5490(2002)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
- Regular price
- $953.00 USD
- Sale price
- $953.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
- Regular price
- $525.00 USD
- Sale price
- $525.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
- Regular price
- $477.00 USD
- Sale price
- $477.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
- Regular price
- $525.00 USD
- Sale price
- $525.00 USD
- Regular price
-
- Unit price
- per
Sold out