
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P05367
Gene Names: Saa2
Organism: Mus musculus (Mouse)
AA Sequence: GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Expression Region: 20-122aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 15.6 kDa
Alternative Name(s): Amyloid fibril protein AA
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: Structure of the murine serum amyloid A gene family. Gene conversion.Lowell C.A., Potter D.A., Stearman R.S., Morrow J.F.J. Biol. Chem. 261:8442-8452(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
- Regular price
- $744.00 USD
- Sale price
- $744.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
- Regular price
- $741.00 USD
- Sale price
- $741.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-1 protein(Saa1)
- Regular price
- $744.00 USD
- Sale price
- $744.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-1 protein(Saa1)
- Regular price
- $744.00 USD
- Sale price
- $744.00 USD
- Regular price
-
- Unit price
- per
Sold out