
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Tags & Cell Markers
Uniprot ID: Q8CGR5
Gene Names: Klk14
Organism: Mus musculus (Mouse)
AA Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN
Expression Region: 24-250aa
Sequence Info: Full Length of Mature Protein
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 26.5 kDa
Alternative Name(s): Glandular kallikrein KLK14
Relevance: Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis Inhibited by SERPINA1, SERPINC1, SERPINE1, SERPINF2, aprotinin, soybean, trypsin inhibitor and leupeptin. Inhibited by serine protease inhibitor SPINK5. Has an autoproteolytic activity which may have a regulatory effect. Activated by citrate and inhibited by zinc and to a lower extent by manganese
Reference: "Organization and evolution of the glandular kallikrein locus in Mus musculus." Olsson A.Y., Lundwall A. Biochem. Biophys. Res. Commun. 299:305-311(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Kallikrein-14(Klk14)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Kallikrein-14(Klk14)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Kallikrein-14(Klk14)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Kallikrein-14(Klk14)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out