>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Immunology
Target / Protein: Il18
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P70380
AA Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Tag info: N-terminal 10xHis-tagged
Expression Region: 1-192aa
Protein length: Full Length
MW: 24.6 kDa
Alternative Name(s): Interferon gamma-inducing factor
Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Reference: "Active stage of autoimmune diabetes is associated with the expression of a novel cytokine, IGIF, which is located near Idd2." Rothe H., Jenkins N.A., Copeland N.G., Kolb H. J. Clin. Invest. 99:469-474(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.