Recombinant Mouse Cerebellin-3(Cbln3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Cerebellin-3(Cbln3)

CSB-CF881291MOa2
Regular price
$583.00 USD
Sale price
$583.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: Q9JHG0

Gene Names: Cbln3

Organism: Mus musculus (Mouse)

AA Sequence: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

Expression Region: 25-197aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.4 kDa

Alternative Name(s):

Relevance: May be involved in synaptic functions in the CNS.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share