Recombinant Mouse C-C motif chemokine 7(Ccl7),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse C-C motif chemokine 7(Ccl7),partial

CSB-RP090994m
Regular price
$739.00 USD
Sale price
$739.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q03366

Gene Names: Ccl7

Organism: Mus musculus (Mouse)

AA Sequence: PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Expression Region: 28-97aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.1 kDa

Alternative Name(s): Intercrine/chemokine MAR;CMonocyte chemoattractant protein 3Monocyte chemotactic protein 3 ;MCP-3;Protein FICSmall-inducible cytokine A7

Relevance: Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity .

Reference: Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells.Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T.J. Exp. Med. 176:1773-1778(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share