Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P10855
Gene Names: Ccl3
Organism: Mus musculus (Mouse)
AA Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Expression Region: 24-92aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.9 kDa
Alternative Name(s): Heparin-binding chemotaxis protein;L2G25BMacrophage inflammatory protein 1-alpha ;MIP-1-alpha;SIS-alpha;Small-inducible cytokine A3TY-5
Relevance: Monokine with inflammatory, pyrogenic and chokinetic properties. Has a potent chotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.
Reference: Macrophages secrete a novel heparin-binding protein with inflammatory and neutrophil chemokinetic properties.Wolpe S.D., Davatelis G., Sherry B., Beutler B., Hesse D.G., Nguyen H.T., Moldawer L.L., Nathan C.F., Lowry S.F., Cerami A.J. Exp. Med. 167:570-581(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.