Recombinant Macaca mulatta C-X-C motif chemokine 10(CXCL10)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca mulatta C-X-C motif chemokine 10(CXCL10)

CSB-EP822646MOW
Regular price
$867.00 USD
Sale price
$867.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q8MIZ1

Gene Names: CXCL10

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Expression Region: 22-98aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.7 kDa

Alternative Name(s): 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10

Relevance: Chotactic for monocytes and T-lymphocytes. Binds to CXCR3 .

Reference: Increased expression of the interferon-gamma-inducible chemokine Mig/CXCL9 in lymphoid tissues during simian immunodeficiency virus infection in vivo.Reinhart T.A., Fallert B.A., Pfeifer M., Capuano S. III, Rajakumar P., Murphey-Corb M., Day R., Fuller C.L., Schaefer T.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share