Recombinant Human Thioredoxin domain-containing protein 12(TXNDC12)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Thioredoxin domain-containing protein 12(TXNDC12)

CSB-EP025371HU
Regular price
$578.00 USD
Sale price
$578.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O95881

Gene Names: TXNDC12

Organism: Homo sapiens (Human)

AA Sequence: HNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL

Expression Region: 27-172aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.4 kDa

Alternative Name(s): Endoplasmic reticulum resident protein 18 ;ER protein 18 ;ERp18Endoplasmic reticulum resident protein 19 ;ER protein 19 ;ERp19Thioredoxin-like protein p19hTLP19

Relevance: Possesses significant protein thiol-disulfide oxidase activity.

Reference: Solution structure and dynamics of ERp18, a small endoplasmic reticulum resident oxidoreductase.Rowe M.L., Ruddock L.W., Kelly G., Schmidt J.M., Williamson R.A., Howard M.J.Biochemistry 48:4596-4606(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share