Recombinant Human Sodium-dependent phosphate transport protein 2B(SLC34A2),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Sodium-dependent phosphate transport protein 2B(SLC34A2),partial

CSB-EP021581HU
Regular price
$570.00 USD
Sale price
$570.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O95436

Gene Names: SLC34A2

Organism: Homo sapiens (Human)

AA Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Expression Region: 574-689aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 27.1 kDa

Alternative Name(s): Na(+)-dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B

Relevance: May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Reference: "Regulation of the human sodium-phosphate cotransporter NaPi-IIb gene promoter by epidermal growth factor." Xu H., Collins J.F., Bai L., Kiela P.R., Ghishan F.K. Am. J. Physiol. 280:C628-C636(2001)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share