Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein(SERS),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein(SERS),partial

CSB-RP041444h
Regular price
$577.00 USD
Sale price
$577.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: P49591

Gene Names: SERS

Organism: Homo sapiens (Human)

AA Sequence: VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV

Expression Region: 2-233aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 53.4 kDa

Alternative Name(s): Seryl-tRNA synthetase ;SerRSSeryl-tRNA(Ser/Sec) synthetase

Relevance: Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).

Reference: Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.Vincent C., Tarbouriech N., Haertlein M.Eur. J. Biochem. 250:77-84(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share