
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P49908
Gene Names: SEPP1
Organism: Homo sapiens (Human)
AA Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN
Expression Region: 20-381aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 42.6 kDa
Alternative Name(s):
Relevance: Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
Reference: Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.Hill K.E., Lloyd R.S., Burk R.F.Proc. Natl. Acad. Sci. U.S.A. 90:537-541(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Selenoprotein P(SEPP1)
- Regular price
- $578.00 USD
- Sale price
- $578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Selenoprotein P(SEPP1)
- Regular price
- $578.00 USD
- Sale price
- $578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Selenoprotein M(SELM)
- Regular price
- $745.00 USD
- Sale price
- $745.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human N-myc proto-oncogene protein(MYCN)
- Regular price
- $646.00 USD
- Sale price
- $646.00 USD
- Regular price
-
- Unit price
- per
Sold out