
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: Q9BZX4
Gene Names: ROPN1B
Organism: Homo sapiens (Human)
AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Expression Region: 1-120aa
Sequence Info: Full Length of isoform 2
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.6 kDa
Alternative Name(s): Rhophilin-associated protein 1B
Relevance:
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Ropporin-1B(ROPN1B),partial
- Regular price
- $577.00 USD
- Sale price
- $577.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 60S acidic ribosomal protein P1(RPLP1)
- Regular price
- $577.00 USD
- Sale price
- $577.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 40S ribosomal protein S14(RPS14),partial
- Regular price
- $577.00 USD
- Sale price
- $577.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Selenoprotein M(SELM)
- Regular price
- $577.00 USD
- Sale price
- $577.00 USD
- Regular price
-
- Unit price
- per
Sold out