Recombinant Human Rho guanine nucleotide exchange factor 7(ARHGEF7) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Rho guanine nucleotide exchange factor 7(ARHGEF7) ,partial

CSB-RP014454h(C)
Regular price
$578.00 USD
Sale price
$578.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q14155

Gene Names: ARHGEF7

Organism: Homo sapiens (Human)

AA Sequence: MTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYH

Expression Region: 179-428aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 55.3 kDa

Alternative Name(s): Beta-PixCOOL-1;PAK-interacting exchange factor betap85

Relevance: Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce mbrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions . May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons.3 Publications

Reference: A novel regulator of p21-activated kinases.Bagrodia S., Taylor S.J., Jordon K.A., Van Aelst L., Cerione R.A.J. Biol. Chem. 273:23633-23636(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share