
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Cancer
Uniprot ID: P35247
Gene Names: SFTPD
Organism: Homo sapiens (Human)
AA Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Expression Region: 21–375aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 35.2 kDa
Alternative Name(s): Collectin-7 Lung surfactant protein D
Relevance: Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the Extracellular domain reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
Reference: "Purification, characterization and cDNA cloning of human lung surfactant protein D."Lu J., Willis A.C., Reid K.B.M.Biochem. J. 284:795-802(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Pulmonary surfactant-associated protein A2(SFTPA2)
- Regular price
- $668.00 USD
- Sale price
- $668.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein C(SFTPC)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- $524.00 USD
- Sale price
- $524.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- $476.00 USD
- Sale price
- $476.00 USD
- Regular price
-
- Unit price
- per
Sold out