Recombinant Human Neurotensin-neuromedin N(NTS) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Neurotensin-neuromedin N(NTS) ,partial

CSB-EP016136HU
Regular price
$579.00 USD
Sale price
$579.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P30990

Gene Names: NTS

Organism: Homo sapiens (Human)

AA Sequence: SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK

Expression Region: 24-143aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 29.7 kDa

Alternative Name(s): NmN-125Neuromedin N ;NN ;NmNNeurotensin ;NTTail peptide

Relevance: Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.

Reference: Intermolecular interactions between the neurotensin and the third Extracellular domain loop of human neurotensin 1 receptor.Da Costa G., Bondon A., Coutant J., Curmi P., Monti J.P.J. Biomol. Struct. Dyn. 31:1381-1392(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share