
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P49006
Gene Names: MARCKSL1
Organism: Homo sapiens (Human)
AA Sequence: MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
Expression Region: 1-195aa
Sequence Info: Full Length of BC066915
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 46.5 kDa
Alternative Name(s): MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate
Relevance: Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems
Reference: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Macrophage-capping protein(CAPG)
- Regular price
- $578.00 USD
- Sale price
- $578.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human N-myc proto-oncogene protein(MYCN)
- Regular price
- $646.00 USD
- Sale price
- $646.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human LIM and senescent cell antigen-like-containing domain protein 1(LIMS1)
- Regular price
- $739.00 USD
- Sale price
- $739.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Antigen KI-67(MKI67),partial
- Regular price
- $578.00 USD
- Sale price
- $578.00 USD
- Regular price
-
- Unit price
- per
Sold out