
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Metabolism
Uniprot ID: P00338
Gene Names: LDHA
Organism: Homo sapiens (Human)
AA Sequence: KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Expression Region: 5-323aa
Sequence Info: Partial
Source: E.coli
Tag Info: NO-tagged
MW: 35.1 kDa
Alternative Name(s): Cell proliferation-inducing gene 19 protein LDH muscle subunit
Relevance:
Reference: "Genotypic analysis of families with lactate dehydrogenase A (M) deficiency by selective DNA amplification." Maekawa M., Sudo K., Li S.S., Kanno T. Hum. Genet. 88:34-38(1991)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- $743.00 USD
- Sale price
- $743.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- $828.00 USD
- Sale price
- $828.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial
- Regular price
- $743.00 USD
- Sale price
- $743.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human L-lactate dehydrogenase C chain (LDHC) ,partial
- Regular price
- $477.00 USD
- Sale price
- $477.00 USD
- Regular price
-
- Unit price
- per
Sold out