Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74),partial (Active)

Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74),partial (Active)

CSB-MP004956HU1(F2)
Regular price
$446.00 USD
Sale price
$446.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Immunology

Uniprot NO.:P04233-2

Uniprot Entry Name:

Gene Names:CD74

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:73-232aa

Sequence:QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Protein Description:Partial of Isoform 2

Tag Info:N-terminal 10xHis-tagged

Mol. Weight:21.0 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 ?g/mL can bind Anti-CD74 recombinant antibody (CSB-RA004956A1HU), the EC50 is 1.317-1.646 ng/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74)

Relevance:Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.[Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.[Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2 . Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform .

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)
    Regular price
    $1,350.00 USD
    Sale price
    $1,350.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Basigin(BSG),partial (Active)
    Regular price
    $446.00 USD
    Sale price
    $446.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CD44 antigen(CD44),partial (Active)
    Regular price
    $446.00 USD
    Sale price
    $446.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)
    Regular price
    $587.00 USD
    Sale price
    $587.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share