Recombinant Human Growth-regulated alpha protein(CXCL1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Growth-regulated alpha protein(CXCL1)

CSB-EP609HU
Regular price
$576.00 USD
Sale price
$576.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P09341

Gene Names: CXCL1

Organism: Homo sapiens (Human)

AA Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Expression Region: 35-107aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.9 kDa

Alternative Name(s): C-X-C motif chemokine 1 GRO-alpha(1-73) Melanoma growth stimulatory activity Short name: MGSA Neutrophil-activating protein 3 Short name: NAP-3

Relevance: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.

Reference: "Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin."Richmond A., Balentien E., Thomas H.G., Flaggs G., Barton D.E., Spiess J., Bordoni R., Francke U., Derynck R.EMBO J. 7:2025-2033(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Growth-regulated alpha protein(CXCL1)
    Regular price
    $576.00 USD
    Sale price
    $576.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Growth-regulated alpha protein(CXCL1) (Active)
    Regular price
    $1,189.00 USD
    Sale price
    $1,189.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • CXCL1 Antibody, HRP conjugated - Cat. #: CSB-PA06097B0Rb
    Regular price
    $351.00 USD
    Sale price
    $351.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human C-X-C motif chemokine 3(CXCL3)
    Regular price
    $576.00 USD
    Sale price
    $576.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share