
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: P09341
Gene Names: CXCL1
Organism: Homo sapiens (Human)
AA Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Expression Region: 35-107aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 23.9 kDa
Alternative Name(s): C-X-C motif chemokine 1 GRO-alpha(1-73) Melanoma growth stimulatory activity Short name: MGSA Neutrophil-activating protein 3 Short name: NAP-3
Relevance: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity.
Reference: "Molecular characterization and chromosomal mapping of melanoma growth stimulatory activity, a growth factor structurally related to beta-thromboglobulin."Richmond A., Balentien E., Thomas H.G., Flaggs G., Barton D.E., Spiess J., Bordoni R., Francke U., Derynck R.EMBO J. 7:2025-2033(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Growth-regulated alpha protein(CXCL1)
- Regular price
- $576.00 USD
- Sale price
- $576.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Growth-regulated alpha protein(CXCL1) (Active)
- Regular price
- $1,189.00 USD
- Sale price
- $1,189.00 USD
- Regular price
-
- Unit price
- per
Sold out -
CXCL1 Antibody, HRP conjugated - Cat. #: CSB-PA06097B0Rb
- Regular price
- $351.00 USD
- Sale price
- $351.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human C-X-C motif chemokine 3(CXCL3)
- Regular price
- $576.00 USD
- Sale price
- $576.00 USD
- Regular price
-
- Unit price
- per
Sold out