Recombinant Human Fractalkine(CX3CL1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Fractalkine(CX3CL1),partial

CSB-EP006235HU(F)
Regular price
$581.00 USD
Sale price
$581.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Adhesion

Uniprot ID: P78423

Gene Names: CX3CL1

Organism: Homo sapiens (Human)

AA Sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Expression Region: 25-100aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.6 kDa

Alternative Name(s): C-X3-C motif chemokine 1CX3C membrane-anchored chemokineNeurotactin;Small-inducible cytokine D1

Relevance: The soluble form is chotactic for T-cells and monocytes, but not for neutrophils. The mbrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.

Reference: Structural basis of chemokine sequestration by CrmD, a poxvirus-encoded tumor necrosis factor receptor.Xue X., Lu Q., Wei H., Wang D., Chen D., He G., Huang L., Wang H., Wang X.PLoS Pathog. 7:E1002162-E1002162(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share