Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cytochrome c oxidase subunit 5A, mitochondrial(COX5A)

CSB-RP004144h
Regular price
$578.00 USD
Sale price
$578.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: P20674

Gene Names: COX5A

Organism: Homo sapiens (Human)

AA Sequence: SHGSQETDEEFDARWVTYFNKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Expression Region: 42-150aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.5 kDa

Alternative Name(s): Cytochrome c oxidase polypeptide Va

Relevance: This is the he A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Reference: Molecular evolution of the cytochrome c oxidase subunit 5A gene in primates.Uddin M., Opazo J.C., Wildman D.E., Sherwood C.C., Hof P.R., Goodman M., Grossman L.I.BMC Evol. Biol. 8:8-8(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share