
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Signal Transduction
Uniprot ID: P43235
Gene Names: CTSK
Organism: Homo sapiens (Human)
AA Sequence: APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Expression Region: 115-329aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 25.5 kDa
Alternative Name(s): Cathepsin OCathepsin O2;Cathepsin X
Relevance: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation.
Reference: Molecular cloning of human cathepsin O, a novel endoproteinase and homologue of rabbit OC2.Shi G.-P., Chapman H.A., Bhairi S.M., Deleeuw C., Reddy V.Y., Weiss S.J.FEBS Lett. 357:129-134(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Cathepsin K(CTSK)
- Regular price
- $577.00 USD
- Sale price
- $577.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Cathepsin K(Ctsk)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Cathepsin K(Ctsk)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Cathepsin K(Ctsk)
- Regular price
- $737.00 USD
- Sale price
- $737.00 USD
- Regular price
-
- Unit price
- per
Sold out