Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cardiovascular
Uniprot ID: O00253
Gene Names: AGRP
Organism: Homo sapiens (Human)
AA Sequence: SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Expression Region: 83-132aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 32.7 kDa
Alternative Name(s):
Relevance: Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin syst. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.5 Publications
Reference: Characterization of Agouti-related protein binding to melanocortin receptors.Yang Y.K., Thompson D.A., Dickinson C.J., Wilken J., Barsh G.S., Kent S.B., Gantz I.Mol. Endocrinol. 13:148-155(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.