Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase(NUDT1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase(NUDT1)

CSB-YP016154HUa0
Regular price
$738.00 USD
Sale price
$738.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P36639

Gene Names: NUDT1

Organism: Homo sapiens (Human)

AA Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Expression Region: 19-197aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 22.3 kDa

Alternative Name(s): 2-hydroxy-dATP diphosphatase (EC:3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1

Relevance: Antimutagenic. Acts as a sanitizing enzyme for oxidized nucleotide pools, thus suppressing cell dysfunction and death induced by oxidative stress. Hydrolyzes 8-oxo-dGTP, 8-oxo-dATP and 2-OH-dATP, thus preventing misincorporation of oxidized purine nucleoside triphosphates into DNA and subsequently preventing A:T to C:G and G:C to T:A transversions. Able to hydrolyze also the corresponding ribonucleotides, 2-OH-ATP, 8-oxo-GTP and 8-oxo-ATP. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.

Reference: "Genomic structure and chromosome location of the human mutT homologue gene MTH1 encoding 8-oxo-dGTPase for prevention of A:T to C:G transversion." Furuichi M., Yoshida M.C., Oda H., Tajiri T., Nakabeppu Y., Tsuzuki T., Sekiguchi M. Genomics 24:485-490(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase(NUDT1)
    Regular price
    $746.00 USD
    Sale price
    $746.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase(NUDT1)
    Regular price
    $457.00 USD
    Sale price
    $457.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human 7,8-dihydro-8-oxoguanine triphosphatase(NUDT1)
    Regular price
    $511.00 USD
    Sale price
    $511.00 USD
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Deoxyguanosine kinase, mitochondrial(DGUOK)
    Regular price
    $579.00 USD
    Sale price
    $579.00 USD
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share