Recombinant Hirudo nipponia Guamerin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Hirudo nipponia Guamerin

CSB-YP342406HHK
Regular price
$953.00 USD
Sale price
$953.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein:

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Hirudo nipponia (Korean blood-sucking leech)

Delivery time: 3-7 business days

Uniprot ID: P46443

AA Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-57aa

Protein length: Full Length

MW: 8.1 kDa

Alternative Name(s):

Relevance: Inhibits mammalian elastases.

Reference: "Isolation and characterization of guamerin, a new human leukocyte elastase inhibitor from Hirudo nipponia."Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share