Recombinant Helicobacter pylori Uncharacterized protein HP_0085 (HP_0085)

CSB-CF354944HUV

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Uniprot NO.:P64651

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQKEQEAQEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASAQMSHQIKKIEERLNQE QK

Protein Names:Recommended name: Uncharacterized protein HP_0085

Gene Names:Ordered Locus Names:HP_0085

Expression Region:1-62

Sequence Info:full length protein