
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0A911
Gene Names: ompA
Organism: Escherichia coli O157:H7
AA Sequence: WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Expression Region: 164-346aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 35.6 kDa
Alternative Name(s): Outer membrane protein II*
Relevance: Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes
Reference: "Genome sequence of enterohaemorrhagic Escherichia coli O157:H7."Perna N.T., Plunkett G. III, Burland V., Mau B., Glasner J.D., Rose D.J., Mayhew G.F., Evans P.S., Gregor J., Kirkpatrick H.A., Posfai G., Hackett J., Klink S., Boutin A., Shao Y., Miller L., Grotbeck E.J., Davis N.W. Blattner F.R.Nature 409:529-533(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Outer membrane protein C (ompC)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein A(ompA)
- Regular price
- $2,284.00 USD
- Sale price
- $2,284.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein C(ompC)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli O157:H7 Outer membrane protein C (ompC)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out