
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P04393
Gene Names: ecoRVM
Organism: Escherichia coli
AA Sequence: MKDKVFVPPIKSQGIKTKLVPCIKRIVPKNFNGVWVEPFMGTGVVAFNVAPKDALLCDTNPHLISFYNALKNKDITGDLVKDFLYREGEKLLLSNGEYYYEVRERFNNYKEPLDFLFLNRSCFNGMIRFNSKGGFNVPFCKKPNRFAQAYITKISNQVDRISEIISKGNYTFLCQSFEKTIGMVNRDDVVYCDPPYIGRHVDYFNSWGERDERLLFETLSSLNATFITSTWHHNDYRENKYVRDLWSSFRILTKEHFYHVGASEKNRSPMVEALITNIAKDIIDHIEKSSGDILVIEE
Expression Region: 1-298aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 50.6 kDa
Alternative Name(s): Adenine-specific methyltransferase EcoRV
Relevance: This methylase recognizes the double-stranded sequence GATATC, causes specific methylation on A-2 on both strands, and protects the DNA from cleavage by the EcoRV endonuclease.
Reference: Characterization of the genes coding for the Eco RV restriction and modification system of Escherichia coli.Bougueleret L., Schwarzstein M., Tsugita A., Zabeau M.Nucleic Acids Res. 12:3659-3676(1984)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli Adenosine deaminase(add)
- Regular price
- $869.00 USD
- Sale price
- $869.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Purine nucleoside phosphorylase DeoD-type(deoD)
- Regular price
- $869.00 USD
- Sale price
- $869.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Metalloprotease LoiP(loiP)
- Regular price
- $739.00 USD
- Sale price
- $739.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Cystathionine beta-lyase metC(metC),partial
- Regular price
- $869.00 USD
- Sale price
- $869.00 USD
- Regular price
-
- Unit price
- per
Sold out