Recombinant Escherichia coli 30S ribosomal protein S10(rpsJ)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Escherichia coli 30S ribosomal protein S10(rpsJ)

CSB-RP087644Ba
Regular price
$870.00 USD
Sale price
$870.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0A7R5

Gene Names: rpsJ

Organism: Escherichia coli (strain K12)

AA Sequence: MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Expression Region: 1-103aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 38.7 kDa

Alternative Name(s):

Relevance: Involved in the binding of tRNA to the ribosomes.

Reference: All-atom homology model of the Escherichia coli 30S ribosomal subunit.Tung C.-S., Joseph S., Sanbonmatsu K.Y.Nat. Struct. Biol. 9:750-755(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share