Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B(stxB2)

CSB-YP357663ECC
Regular price
$952.00 USD
Sale price
$952.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: stxB2

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Enterobacteria phage 933W (Bacteriophage 933W)

Delivery time: 3-7 business days

Uniprot ID: P09386

AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND

Tag info: N-terminal 6xHis-tagged

Expression Region: 20-89aa

Protein length: Full Length of Mature Protein

MW: 9.8 kDa

Alternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B

Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Reference: Nucleotide sequence analysis and comparison of the structural genes for Shiga-like toxin I and Shiga-like toxin II encoded by bacteriophages from Escherichia coli 933.Jackson M.P., Neill R.J., O'Brien A.D., Holmes R.K., Newland J.W.FEMS Microbiol. Lett. 44:109-114(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share