
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P25687
Gene Names: N/A
Organism: Dendroaspis polylepis polylepis (Black mamba)
AA Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS
Expression Region: 1-81aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 24.6 kDa
Alternative Name(s): Short name: MIT 1 Alternative name(s): Black mamba intestinal toxin 1 Black mamba venom protein A
Relevance: Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel.
Reference: "MIT1, a black mamba toxin with a new and highly potent activity on intestinal contraction."Schweitz H., Pascaud P., Diochot S., Moinier D., Lazdunski M.FEBS Lett. 461:183-188(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Androctonus australis Alpha-mammal toxin AaH2
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Chironex fleckeri Toxin CfTx-1,partial
- Regular price
- $738.00 USD
- Sale price
- $738.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Decorin(Dcn) ,partial
- Regular price
- $738.00 USD
- Sale price
- $738.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out