Recombinant Coptis japonica S-norcoclaurine synthase 2(PR10A)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Coptis japonica S-norcoclaurine synthase 2(PR10A)

CSB-EP381182CXF
Regular price
$867.00 USD
Sale price
$867.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: A2A1A1

Gene Names: PR10A

Organism: Coptis japonica (Japanese goldthread)

AA Sequence: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE

Expression Region: 20-196aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36 kDa

Alternative Name(s): Pathogenesis related protein 10A ;CjPR10A

Relevance: Involved in the biosynthesis of the common precursor of all benzylisoquinoline alkaloids such as morphine, sanguinarine, codeine or berberine. Condenses dopamine and pyruvic acid or 4-hydroxyphenylpyruvate.

Reference: Functional analysis of norcoclaurine synthase in Coptis japonica.Minami H., Dubouzet E., Iwasa K., Sato F.J. Biol. Chem. 282:6274-6282(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share