
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cell Biology
Target / Protein: pbpA
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
Delivery time: 3-7 business days
Uniprot ID: A5I6G4
AA Sequence: VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 663-830aa
Protein length: Partial
MW: 35.2 kDa
Alternative Name(s): Peptidoglycan TGase DD-transpeptidase
Relevance: Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
Reference: "Analysis of the neurotoxin complex genes in Clostridium botulinum A1-A4 and B1 strains: BoNT/A3, /Ba4 and /B1 clusters are located within plasmids." Smith T.J., Hill K.K., Foley B.T., Detter J.C., Munk A.C., Bruce D.C., Doggett N.A., Smith L.A., Marks J.D., Xie G., Brettin T.S. PLoS ONE 2:E1271-E1271(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Clostridium botulinum Penicillin-binding protein 1A(pbpA),partial
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A(mrcA) ,partial
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
pbpA Antibody, Biotin conjugated - Cat. #: CSB-PA401992HD01CWV
- Regular price
- $351.00 USD
- Sale price
- $351.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit(clpP)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out