Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chelonia mydas (Green sea-turtle) (Chelonia agassizi)
Uniprot NO.:Q9XPI2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPQLNPAPWFMILSSTWLIYTIILQPKILSHLPTNNPTNKNNKINTNSWTWPWTQHSSTN S
Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Gene Names:Name:MT-ATP8 Synonyms:ATP8, ATPASE8, MTATP8
Expression Region:1-61
Sequence Info:full length protein
You may also like
-
Recombinant Sheep ATP synthase protein 8(MT-ATP8)
- Regular price
- $1,143.00 USD
- Sale price
- $1,143.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Metridium senile ATP synthase protein 8(MTATP8)
- Regular price
- $1,148.00 USD
- Sale price
- $1,148.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Glis glis ATP synthase protein 8(MT-ATP8)
- Regular price
- $1,144.00 USD
- Sale price
- $1,144.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human ATP synthase protein 8(MT-ATP8)
- Regular price
- $1,145.00 USD
- Sale price
- $1,145.00 USD
- Regular price
-
- Unit price
- per
Sold out