
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)
Uniprot NO.:P36342
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RVPAGEGEYVPVERSLTRVNPGRFRGAHLPPLEQKTDPPDVRRVYHVQPFVENPFQTPSV PVAVYYAVLERACRSVLLWAPTEAVQVVRGAPEATRSDARYNLTVAWYRTSDDCAIPILV MEYAECQYDKPLGACPVRNLPRWSFYDSFSATGDDDLGLLMHAPAFETAGTYVRLVKVNG WVEVTQFIFEHRGKGPCRYTLPLRILPAACLRAPVFEQGVTVDAIGMLPRFIPENQRIVA VYSLQAAGWHGPKAPFTSTLLPPEVVETANVTRPELAPEERGTSRTPGDEPAPAVAAQLP PNWHVPEASDVTIQGPAPAPSGHTGAVVGALAGAGLAAGVVVLAVYLVRRRGRAAGKHVR LPELLEEAHGPARRGAPY
Protein Names:Recommended name: Envelope glycoprotein D Short name= gD
Gene Names:Name:gD
Expression Region:18-395
Sequence Info:full length protein
You may also like
-
Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein E(gE)
- Regular price
- $1,541.00 USD
- Sale price
- $1,541.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human herpesvirus 1 Envelope glycoprotein D(gD)
- Regular price
- $1,413.00 USD
- Sale price
- $1,413.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human herpesvirus 1 Envelope glycoprotein D(gD)
- Regular price
- $1,413.00 USD
- Sale price
- $1,413.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human herpesvirus 1 Envelope glycoprotein D(gD)
- Regular price
- $1,413.00 USD
- Sale price
- $1,413.00 USD
- Regular price
-
- Unit price
- per
Sold out