
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P19707
Gene Names: SAA1
Organism: Felis catus (Cat) (Felis silvestris catus)
AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Expression Region: 1-90aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 12.1 kDa
Alternative Name(s): Amyloid fibril protein AACurated
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: Initial sequence and comparative analysis of SAA cat genome.Pontius J.U., Mullikin J.C., Smith D.R., Lindblad-Toh K., Gnerre S., Clamp M., Chang J., Stephens R., Neelam B., Volfovsky N., Schaffer A.A., Agarwala R., Narfstrom K., Murphy W.J., Giger U., Roca A.L., Antunes A., Menotti-Raymond M. , Yuhki N., Pecon-Slattery J., Johnson W.E., Bourque G., Tesler G., O'Brien S.J.Genome Res. 17:1675-1689(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Cat Amyloid protein A(SAA1),partial
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Felis catus (Cat) (Felis silvestris catus) Amyloid protein A(SAA1),partial
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Horse Serum amyloid A protein(SAA1)
- Regular price
- $867.00 USD
- Sale price
- $867.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Horse Serum amyloid A(SAA1)
- Regular price
- $951.00 USD
- Sale price
- $951.00 USD
- Regular price
-
- Unit price
- per
Sold out